SCOPe 2.07: Domain d5w5xl2: 5w5x L:107-212

Lineage for d5w5xl2 (5w5x L:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (18 PDB entries)

8. Domain d5w5xl2: 5w5x L:107-212 [354105]
   Other proteins in same PDB: d5w5xa_
   automated match to d3b9kc2
   complexed with edo, zn

Details for d5w5xl2

PDB Entry: 5w5x, 2.5 Å

PDB Description: crystal structure of baxp168g in complex with an activating antibody

PDB Compounds: (L:) 3C10 Fab' light chain

SCOPe Domain Sequences for d5w5xl2:

Sequence; same for both SEQRES and ATOM records:

>d5w5xl2 b.1.1.0 (L:107-212) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsmeqltsggatvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnrne

Timeline for d5w5xl2:

• d5w5xl2 is new in SCOPe 2.07-stable
  
• d5w5xl2 appears in the current release, SCOPe 2.08