Lineage for d5w5xl1 (5w5x L:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761378Domain d5w5xl1: 5w5x L:1-106 [354104]
    Other proteins in same PDB: d5w5xa_, d5w5xh_
    automated match to d3b9kc1
    complexed with edo, zn

Details for d5w5xl1

PDB Entry: 5w5x (more details), 2.5 Å

PDB Description: crystal structure of baxp168g in complex with an activating antibody
PDB Compounds: (L:) 3C10 Fab' light chain

SCOPe Domain Sequences for d5w5xl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w5xl1 b.1.1.0 (L:1-106) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspsflsasvgdrvtinckasqnvnkyldwyqqnlgeppklliyhtnslptgips
rfsgsgsgtdftltisslqvedvatyfclqhdsgltfgsgtkleik

SCOPe Domain Coordinates for d5w5xl1:

Click to download the PDB-style file with coordinates for d5w5xl1.
(The format of our PDB-style files is described here.)

Timeline for d5w5xl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w5xl2