SCOPe 2.08: Domain d5zh4b1: 5zh4 B:77-222

Lineage for d5zh4b1 (5zh4 B:77-222)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries)

8. Domain d5zh4b1: 5zh4 B:77-222 [354074]
   Other proteins in same PDB: d5zh4a2, d5zh4b2
   automated match to d3bjua1
   complexed with 9cc, cl, lys

Details for d5zh4b1

PDB Entry: 5zh4, 2.6 Å

PDB Description: crystal structure of pfkrs with inhibitor clado-7

PDB Compounds: (B:) Lysine-tRNA ligase

SCOPe Domain Sequences for d5zh4b1:

Sequence, based on SEQRES records:

>d5zh4b1 b.40.4.0 (B:77-222) automated matches {Plasmodium falciparum [TaxId: 5843]}
evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
gkskkgelsifpketillsaclhmlp

Sequence, based on observed residues (ATOM records):

>d5zh4b1 b.40.4.0 (B:77-222) automated matches {Plasmodium falciparum [TaxId: 5843]}
evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgehledtilnitgr
imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
slsifpketillsaclhmlp

Timeline for d5zh4b1:

• d5zh4b1 first appeared in SCOPe 2.07