Lineage for d5w5zl2 (5w5z L:107-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2358794Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (14 PDB entries)
  8. 3054006Domain d5w5zl2: 5w5z L:107-212 [354068]
    automated match to d3b9kc2
    complexed with edo, mes, pg4, pge

Details for d5w5zl2

PDB Entry: 5w5z (more details), 2 Å

PDB Description: crystal structure of baxp168g in complex with an activating antibody at high resolution
PDB Compounds: (L:) 3C10 Fab light chain

SCOPe Domain Sequences for d5w5zl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w5zl2 b.1.1.0 (L:107-212) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsmeqltsggatvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnrne

SCOPe Domain Coordinates for d5w5zl2:

Click to download the PDB-style file with coordinates for d5w5zl2.
(The format of our PDB-style files is described here.)

Timeline for d5w5zl2:

  • d5w5zl2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28