Lineage for d5w5xa_ (5w5x A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575217Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2575295Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2575296Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2575422Protein Proapoptotic molecule Bax [56862] (3 species)
  7. 2575423Species Human (Homo sapiens) [TaxId:9606] [56863] (7 PDB entries)
  8. 3053974Domain d5w5xa_: 5w5x A: [354036]
    Other proteins in same PDB: d5w5xl1, d5w5xl2
    automated match to d2k7wa_
    complexed with edo, zn

Details for d5w5xa_

PDB Entry: 5w5x (more details), 2.5 Å

PDB Description: crystal structure of baxp168g in complex with an activating antibody
PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d5w5xa_:

Sequence, based on SEQRES records: (download)

>d5w5xa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
gptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseslkrigdeld
snmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpe
lirtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiw

Sequence, based on observed residues (ATOM records): (download)

>d5w5xa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
gptsseqimktgalllqgfiqdragrmggeadastkklseslkrigdeldsnmelqrmia
avdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimgwtl
dflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiw

SCOPe Domain Coordinates for d5w5xa_:

Click to download the PDB-style file with coordinates for d5w5xa_.
(The format of our PDB-style files is described here.)

Timeline for d5w5xa_:

  • d5w5xa_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-28