Lineage for d5vyec_ (5vye C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505388Species Pseudomonas putida [TaxId:303] [339955] (2 PDB entries)
  8. 2505392Domain d5vyec_: 5vye C: [354029]
    automated match to d1svvb_
    complexed with gol, plr

Details for d5vyec_

PDB Entry: 5vye (more details), 2.28 Å

PDB Description: crystal structure of l-threonine aldolase from pseudomonas putida
PDB Compounds: (C:) L-threonine aldolase

SCOPe Domain Sequences for d5vyec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vyec_ c.67.1.0 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
sqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevffafng
taanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpqsire
valkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftnacaf
lgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlaskmrfl
sapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpehaieal
rakgwrfytfigsggarfmcswdteeervrelaadirsiita

SCOPe Domain Coordinates for d5vyec_:

Click to download the PDB-style file with coordinates for d5vyec_.
(The format of our PDB-style files is described here.)

Timeline for d5vyec_: