Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
Protein automated matches [336552] (9 species) not a true protein |
Species Chaetoceros socialis [TaxId:163503] [353971] (1 PDB entry) |
Domain d5oyan_: 5oya N: [353972] Other proteins in same PDB: d5oyaa1, d5oyaa2, d5oyab1, d5oyab2, d5oyac1, d5oyac2, d5oyad1, d5oyad2, d5oyae1, d5oyae2, d5oyaf1, d5oyaf2, d5oyag1, d5oyag2, d5oyah1, d5oyah2 automated match to d1iwab_ complexed with cap, edo, mg |
PDB Entry: 5oya (more details), 1.8 Å
SCOPe Domain Sequences for d5oyan_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oyan_ d.73.1.0 (N:) automated matches {Chaetoceros socialis [TaxId: 163503]} mrltqgcfsflpdltdaqiekqvayamsrgwamnvewtddphprnnywelwglplfdikd patvmfelnearkscaagyirmnafdasygtescvmsfltnrpanepgfyldrtdgigrq iiysiksysvqanpegsry
Timeline for d5oyan_: