Lineage for d6cepa2 (6cep A:161-331)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557171Protein automated matches [226882] (9 species)
    not a true protein
  7. 3053805Species Sus scrofa [TaxId:9823] [353867] (2 PDB entries)
  8. 3053908Domain d6cepa2: 6cep A:161-331 [353970]
    Other proteins in same PDB: d6cepa1, d6cepb1, d6cepc1, d6cepd1
    automated match to d5ldha2
    complexed with nad, oxm

Details for d6cepa2

PDB Entry: 6cep (more details), 2 Å

PDB Description: sus scrofa heart l-lactate dehydrogenase ternary complex with nadh and oxamate
PDB Compounds: (A:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d6cepa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cepa2 d.162.1.1 (A:161-331) automated matches {Sus scrofa [TaxId: 9823]}
sgcnldsarfrylmaeklgvhpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvqgm
ygienevflslpcvlnargltsvinqklkddevaqlknsadtlwgiqkdlk

SCOPe Domain Coordinates for d6cepa2:

Click to download the PDB-style file with coordinates for d6cepa2.
(The format of our PDB-style files is described here.)

Timeline for d6cepa2:

  • d6cepa2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28