Lineage for d6cepa1 (6cep A:1-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844936Species Pig (Sus scrofa) [TaxId:9823] [353863] (2 PDB entries)
  8. 2844937Domain d6cepa1: 6cep A:1-160 [353969]
    Other proteins in same PDB: d6cepa2, d6cepb2, d6cepc2, d6cepd2
    automated match to d5ldha1
    complexed with nad, oxm

Details for d6cepa1

PDB Entry: 6cep (more details), 2 Å

PDB Description: sus scrofa heart l-lactate dehydrogenase ternary complex with nadh and oxamate
PDB Compounds: (A:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d6cepa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cepa1 c.2.1.5 (A:1-160) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

SCOPe Domain Coordinates for d6cepa1:

Click to download the PDB-style file with coordinates for d6cepa1.
(The format of our PDB-style files is described here.)

Timeline for d6cepa1: