Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein automated matches [226881] (8 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [353863] (2 PDB entries) |
Domain d6cepa1: 6cep A:1-160 [353969] Other proteins in same PDB: d6cepa2, d6cepb2, d6cepc2, d6cepd2 automated match to d5ldha1 complexed with nad, oxm |
PDB Entry: 6cep (more details), 2 Å
SCOPe Domain Sequences for d6cepa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cepa1 c.2.1.5 (A:1-160) automated matches {Pig (Sus scrofa) [TaxId: 9823]} atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig
Timeline for d6cepa1: