Lineage for d6c0ma_ (6c0m A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2398492Protein automated matches [193245] (17 species)
    not a true protein
  7. 3053886Species Human respirovirus 3 [TaxId:11216] [353948] (1 PDB entry)
  8. 3053887Domain d6c0ma_: 6c0m A: [353949]
    automated match to d4wefa_
    complexed with 8lm, bma, ca, edo, gol, man, nag, so4

Details for d6c0ma_

PDB Entry: 6c0m (more details), 1.83 Å

PDB Description: the synthesis, biological evaluation and structural insights of unsaturated 3-n-substituted sialic acids as probes of human parainfluenza virus-3 haemagglutinin-neuraminidase
PDB Compounds: (A:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d6c0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c0ma_ b.68.1.1 (A:) automated matches {Human respirovirus 3 [TaxId: 11216]}
ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvindl
iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
ntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyps
vgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsi
ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
rvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpm
lfkteipkscs

SCOPe Domain Coordinates for d6c0ma_:

Click to download the PDB-style file with coordinates for d6c0ma_.
(The format of our PDB-style files is described here.)

Timeline for d6c0ma_:

  • d6c0ma_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-28