SCOPe 2.08: Domain d6dt4a2: 6dt4 A:139-208

Lineage for d6dt4a2 (6dt4 A:139-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [353904] (1 PDB entry)

8. Domain d6dt4a2: 6dt4 A:139-208 [353911]
   Other proteins in same PDB: d6dt4a1, d6dt4b1
   automated match to d4i02a2
   protein/DNA complex; complexed with cl, cmp

Details for d6dt4a2

PDB Entry: 6dt4, 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of camp-regulatory protein from yersinia pestis in complex with camp

PDB Compounds: (A:) Cyclic AMP receptor protein

SCOPe Domain Sequences for d6dt4a2:

Sequence; same for both SEQRES and ATOM records:

>d6dt4a2 a.4.5.0 (A:139-208) automated matches {Yersinia pestis [TaxId: 214092]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d6dt4a2:

• d6dt4a2 first appeared in SCOPe 2.07