SCOPe 2.08: Domain d6dt4a1: 6dt4 A:6-138

Lineage for d6dt4a1 (6dt4 A:6-138)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (10 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [353902] (1 PDB entry)

8. Domain d6dt4a1: 6dt4 A:6-138 [353910]
   Other proteins in same PDB: d6dt4a2, d6dt4b2
   automated match to d4i02b1
   protein/DNA complex; complexed with cl, cmp

Details for d6dt4a1

PDB Entry: 6dt4, 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of camp-regulatory protein from yersinia pestis in complex with camp

PDB Compounds: (A:) Cyclic AMP receptor protein

SCOPe Domain Sequences for d6dt4a1:

Sequence; same for both SEQRES and ATOM records:

>d6dt4a1 b.82.3.2 (A:6-138) automated matches {Yersinia pestis [TaxId: 214092]}
pqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyl
nqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlssqmanrl
qitsekvgnlafl

Timeline for d6dt4a1:

• d6dt4a1 first appeared in SCOPe 2.07