Lineage for d6dt4b2 (6dt4 B:139-208)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (80 species)
    not a true protein
  7. 3053842Species Yersinia pestis [TaxId:214092] [353904] (1 PDB entry)
  8. 3053843Domain d6dt4b2: 6dt4 B:139-208 [353905]
    Other proteins in same PDB: d6dt4a1, d6dt4b1
    automated match to d4i02a2

Details for d6dt4b2

PDB Entry: 6dt4 (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of camp-regulatory protein from yersinia pestis in complex with camp
PDB Compounds: (B:) Cyclic AMP receptor protein

SCOPe Domain Sequences for d6dt4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dt4b2 a.4.5.0 (B:139-208) automated matches {Yersinia pestis [TaxId: 214092]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d6dt4b2:

Click to download the PDB-style file with coordinates for d6dt4b2.
(The format of our PDB-style files is described here.)

Timeline for d6dt4b2:

  • d6dt4b2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6dt4b1