SCOPe 2.08: Domain d6cepd2: 6cep D:161-332

Lineage for d6cepd2 (6cep D:161-332)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [353867] (2 PDB entries)

8. Domain d6cepd2: 6cep D:161-332 [353898]
   Other proteins in same PDB: d6cepa1, d6cepb1, d6cepc1, d6cepd1
   automated match to d5ldha2
   complexed with nad, oxm

Details for d6cepd2

PDB Entry: 6cep, 2 Å

PDB Description: sus scrofa heart l-lactate dehydrogenase ternary complex with nadh and oxamate

PDB Compounds: (D:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d6cepd2:

Sequence; same for both SEQRES and ATOM records:

>d6cepd2 d.162.1.1 (D:161-332) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
sgcnldsarfrylmaeklgvhpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvqgm
ygienevflslpcvlnargltsvinqklkddevaqlknsadtlwgiqkdlkd

Timeline for d6cepd2:

• d6cepd2 first appeared in SCOPe 2.07