SCOPe 2.08: Domain d6citb_: 6cit B:

Lineage for d6citb_ (6cit B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries)

8. Domain d6citb_: 6cit B: [353874]
   Other proteins in same PDB: d6cita_
   automated match to d5uwsb_
   complexed with cl, gnp, gol, mg

Details for d6citb_

PDB Entry: 6cit, 2.03 Å

PDB Description: crystal structure of mvm ns2 nes peptide in complex with crm1-ran- ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d6citb_:

Sequence, based on SEQRES records:

>d6citb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeinkka

Sequence, based on observed residues (ATOM records):

>d6citb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
fekaqeinkka

Timeline for d6citb_:

• d6citb_ first appeared in SCOPe 2.07