Lineage for d6a31a_ (6a31 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2465875Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2465889Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2465890Protein automated matches [193326] (11 species)
    not a true protein
  7. 2465891Species Acinetobacter baumannii [TaxId:575584] [196867] (24 PDB entries)
  8. 3053775Domain d6a31a_: 6a31 A: [353837]
    automated match to d4qaja_
    complexed with na

Details for d6a31a_

PDB Entry: 6a31 (more details), 2.19 Å

PDB Description: crystal structure of na+ bound peptidyl-trna hydrolase from acinetobacter baumannii at 2.19 a resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d6a31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a31a_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d6a31a_:

Click to download the PDB-style file with coordinates for d6a31a_.
(The format of our PDB-style files is described here.)

Timeline for d6a31a_:

  • d6a31a_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-28