Lineage for d5o79a_ (5o79 A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2575890Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2575961Protein automated matches [190289] (6 species)
    not a true protein
  7. 2575999Species Klebsiella pneumoniae [TaxId:573] [340493] (3 PDB entries)
  8. 3053764Domain d5o79a_: 5o79 A: [353826]
    automated match to d1osma_
    complexed with c8e, mg

Details for d5o79a_

PDB Entry: 5o79 (more details), 1.65 Å

PDB Description: klebsiella pneumoniae ompk36
PDB Compounds: (A:) ompk36

SCOPe Domain Sequences for d5o79a_:

Sequence, based on SEQRES records: (download)

>d5o79a_ f.4.3.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
ltydiwdgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqty
natragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvga
tyyfnknmstyvdykinllddnsftrnagistddvvalglvyqf

Sequence, based on observed residues (ATOM records): (download)

>d5o79a_ f.4.3.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
ltydgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqtynat
ragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvgatyy
fnknmstyvdykinllddnsftrnagistddvvalglvyqf

SCOPe Domain Coordinates for d5o79a_:

Click to download the PDB-style file with coordinates for d5o79a_.
(The format of our PDB-style files is described here.)

Timeline for d5o79a_:

  • d5o79a_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-21