Lineage for d5vg7a4 (5vg7 A:422-562)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975468Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2975469Protein automated matches [254722] (4 species)
    not a true protein
  7. 2975473Species Human (Homo sapiens) [TaxId:9606] [316258] (14 PDB entries)
  8. 2975482Domain d5vg7a4: 5vg7 A:422-562 [353818]
    Other proteins in same PDB: d5vg7a1, d5vg7a2, d5vg7a3, d5vg7a5, d5vg7b1, d5vg7b2, d5vg7b3, d5vg7b5
    automated match to d5jn5a4
    complexed with gol, mg, so4

Details for d5vg7a4

PDB Entry: 5vg7 (more details), 1.95 Å

PDB Description: crystal structure of the r503q missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5vg7a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vg7a4 d.129.2.0 (A:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfqlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOPe Domain Coordinates for d5vg7a4:

Click to download the PDB-style file with coordinates for d5vg7a4.
(The format of our PDB-style files is described here.)

Timeline for d5vg7a4: