SCOPe 2.08: Domain d5vg7a2: 5vg7 A:192-304

Lineage for d5vg7a2 (5vg7 A:192-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.0: automated matches [254314] (1 protein)
   not a true family

6. Protein automated matches [254721] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries)

8. Domain d5vg7a2: 5vg7 A:192-304 [353816]
   Other proteins in same PDB: d5vg7a4, d5vg7a5, d5vg7b4, d5vg7b5
   automated match to d5epca2
   complexed with gol, mg, so4

Details for d5vg7a2

PDB Entry: 5vg7, 1.95 Å

PDB Description: crystal structure of the r503q missense variant of human pgm1

PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5vg7a2:

Sequence; same for both SEQRES and ATOM records:

>d5vg7a2 c.84.1.0 (A:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

Timeline for d5vg7a2:

• d5vg7a2 first appeared in SCOPe 2.07