Lineage for d5zzva_ (5zzv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889301Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries)
  8. 2889325Domain d5zzva_: 5zzv A: [353792]
    automated match to d4qaja_
    complexed with edo

Details for d5zzva_

PDB Entry: 5zzv (more details), 1.57 Å

PDB Description: crystal structure of peg-1500 crystallized peptidyl-trna hydrolase from acinetobacter baumannii at 1.5 a resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5zzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zzva_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d5zzva_:

Click to download the PDB-style file with coordinates for d5zzva_.
(The format of our PDB-style files is described here.)

Timeline for d5zzva_: