Lineage for d5vbia2 (5vbi A:192-304)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483048Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2483049Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2483141Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2483142Protein automated matches [254721] (3 species)
    not a true protein
  7. 2483143Species Human (Homo sapiens) [TaxId:9606] [316254] (10 PDB entries)
  8. 3053703Domain d5vbia2: 5vbi A:192-304 [353765]
    Other proteins in same PDB: d5vbia4, d5vbia5, d5vbib4
    automated match to d5epca2
    complexed with gol, mg, so4

Details for d5vbia2

PDB Entry: 5vbi (more details), 1.75 Å

PDB Description: crystal structure of the r515w missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5vbia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vbia2 c.84.1.0 (A:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOPe Domain Coordinates for d5vbia2:

Click to download the PDB-style file with coordinates for d5vbia2.
(The format of our PDB-style files is described here.)

Timeline for d5vbia2:

  • d5vbia2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-21