Lineage for d6dqge1 (6dqg E:10-212)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890410Protein automated matches [227004] (3 species)
    not a true protein
  7. 2890449Species Human (Homo sapiens) [TaxId:9606] [353655] (2 PDB entries)
  8. 2890460Domain d6dqge1: 6dqg E:10-212 [353656]
    Other proteins in same PDB: d6dqga2, d6dqgb2, d6dqgc2, d6dqgd2, d6dqge2, d6dqgf2
    automated match to d1l1fa2
    complexed with po4; mutant

Details for d6dqge1

PDB Entry: 6dqg (more details), 2.7 Å

PDB Description: human glutamate dehydrogenase, h454y mutant
PDB Compounds: (E:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d6dqge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dqge1 c.58.1.1 (E:10-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d6dqge1:

Click to download the PDB-style file with coordinates for d6dqge1.
(The format of our PDB-style files is described here.)

Timeline for d6dqge1: