Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein automated matches [227004] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [353655] (2 PDB entries) |
Domain d6dqge1: 6dqg E:10-212 [353656] Other proteins in same PDB: d6dqga2, d6dqgb2, d6dqgc2, d6dqgd2, d6dqge2, d6dqgf2 automated match to d1l1fa2 complexed with po4; mutant |
PDB Entry: 6dqg (more details), 2.7 Å
SCOPe Domain Sequences for d6dqge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dqge1 c.58.1.1 (E:10-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas tighydinahacvtgkpisqggi
Timeline for d6dqge1: