Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d6bpcc2: 6bpc C:131-235 [353652] Other proteins in same PDB: d6bpcb_, d6bpcc1, d6bpce_, d6bpcf1 automated match to d1tqbc2 |
PDB Entry: 6bpc (more details), 2.66 Å
SCOPe Domain Sequences for d6bpcc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bpcc2 b.1.1.2 (C:131-235) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d6bpcc2:
View in 3D Domains from other chains: (mouse over for more information) d6bpcb_, d6bpce_, d6bpcf1, d6bpcf2 |