Lineage for d5yczb_ (5ycz B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385751Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2385752Protein automated matches [190445] (8 species)
    not a true protein
  7. 3053484Species Alocasia macrorrhizos [TaxId:4456] [353546] (2 PDB entries)
  8. 3053513Domain d5yczb_: 5ycz B: [353575]
    automated match to d5dvha_

Details for d5yczb_

PDB Entry: 5ycz (more details), 2.5 Å

PDB Description: crystal structure of alocasin, protease inhibitor from giant taro (arum macrorrhizon)
PDB Compounds: (B:) Trypsin/chymotrypsin inhibitor

SCOPe Domain Sequences for d5yczb_:

Sequence, based on SEQRES records: (download)

>d5yczb_ b.42.4.0 (B:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvk
v

Sequence, based on observed residues (ATOM records): (download)

>d5yczb_ b.42.4.0 (B:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfsgrplaffpena
dddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairkagd
dyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvkv

SCOPe Domain Coordinates for d5yczb_:

Click to download the PDB-style file with coordinates for d5yczb_.
(The format of our PDB-style files is described here.)

Timeline for d5yczb_:

  • d5yczb_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-14

View in 3D
Domains from other chains:
(mouse over for more information)
d5ycza_