SCOPe 2.08: Domain d5xrwd_: 5xrw D:

Lineage for d5xrwd_ (5xrw D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.139: Surface presentation of antigens (SPOA) [101800] (1 superfamily)
   segment-swapped dimer forming two identical conjoint barrels (n=6, S=10) topologically similar to the FMN-binding split barrel

4. Superfamily b.139.1: Surface presentation of antigens (SPOA) [101801] (2 families)
   automatically mapped to Pfam PF01052

5. Family b.139.1.0: automated matches [353558] (1 protein)
   not a true family

6. Protein automated matches [353559] (1 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [353560] (1 PDB entry)

8. Domain d5xrwd_: 5xrw D: [353562]
   automated match to d1o6ab_

Details for d5xrwd_

PDB Entry: 5xrw, 2.5 Å

PDB Description: crystal structure of flagellar motor switch complex from h. pylori

PDB Compounds: (D:) FliY

SCOPe Domain Sequences for d5xrwd_:

Sequence; same for both SEQRES and ATOM records:

>d5xrwd_ b.139.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
plgslnvkvrigqkkmilkdvvsmdigsvveldqlvndpleilvddkviakgevvivdgn
fgiqitdigtkkerleqlk

Timeline for d5xrwd_:

• d5xrwd_ first appeared in SCOPe 2.07