SCOPe 2.08: Domain d5w8mb1: 5w8m B:1-194

Lineage for d5w8mb1 (5w8m B:1-194)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.0: automated matches [191347] (1 protein)
   not a true family

6. Protein automated matches [190255] (6 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [353543] (1 PDB entry)

8. Domain d5w8mb1: 5w8m B:1-194 [353552]
   Other proteins in same PDB: d5w8ma2, d5w8mb2
   automated match to d1w24a_
   complexed with gol, pge

Details for d5w8mb1

PDB Entry: 5w8m, 1.52 Å

PDB Description: crystal structure of chaetomium thermophilum vps29

PDB Compounds: (B:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d5w8mb1:

Sequence, based on SEQRES records:

>d5w8mb1 d.159.1.0 (B:1-194) automated matches {Chaetomium thermophilum [TaxId: 209285]}
maflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdlki
vrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwaggsh
rfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkdeng
tenvavekvtytkp

Sequence, based on observed residues (ATOM records):

>d5w8mb1 d.159.1.0 (B:1-194) automated matches {Chaetomium thermophilum [TaxId: 209285]}
maflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdlki
vrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwaggsh
rfecfeymdkffvnpgsatgafttdvvpsfclmdvqgisltlyvyqlrkdengtenvave
kvtytkp

Timeline for d5w8mb1:

• d5w8mb1 first appeared in SCOPe 2.07