Lineage for d5o5ua3 (5o5u A:594-750)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323461Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2323491Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 2323492Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 2323493Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 2323494Species Human (Homo sapiens) [TaxId:9606] [140575] (33 PDB entries)
    Uniprot Q04609 594-750
  8. 3053445Domain d5o5ua3: 5o5u A:594-750 [353507]
    Other proteins in same PDB: d5o5ua1, d5o5ua2
    automated match to d2c6ca1
    complexed with 9lz, bma, ca, cl, man, nag, zn

Details for d5o5ua3

PDB Entry: 5o5u (more details), 1.53 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a urea based inhibitor psma 1027
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d5o5ua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o5ua3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOPe Domain Coordinates for d5o5ua3:

Click to download the PDB-style file with coordinates for d5o5ua3.
(The format of our PDB-style files is described here.)

Timeline for d5o5ua3:

  • d5o5ua3 appears in periodic updates to SCOPe 2.07 starting on 2018-06-14