Lineage for d6bang_ (6ban G:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1304 PDB entries)
  8. 3053437Domain d6bang_: 6ban G: [353499]
    Other proteins in same PDB: d6band_, d6banf_, d6banh_, d6banm_, d6bann_, d6bano_, d6banp_
    automated match to d5kvel_

Details for d6bang_

PDB Entry: 6ban (more details), 1.95 Å

PDB Description: potent and selective antitumor activity of a t-cell engaging bispecific antibody targeting a membrane-proximal epitope of ror1
PDB Compounds: (G:) Variable domain of R11 Light Chain

SCOPe Domain Sequences for d6bang_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bang_ b.1.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
melvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvp
srfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk

SCOPe Domain Coordinates for d6bang_:

Click to download the PDB-style file with coordinates for d6bang_.
(The format of our PDB-style files is described here.)

Timeline for d6bang_: