Lineage for d6bano_ (6ban O:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584625Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2584626Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2584835Family g.14.1.0: automated matches [254254] (1 protein)
    not a true family
  6. 2584836Protein automated matches [254580] (2 species)
    not a true protein
  7. 2584837Species Human (Homo sapiens) [TaxId:9606] [255350] (9 PDB entries)
  8. 3053417Domain d6bano_: 6ban O: [353479]
    Other proteins in same PDB: d6bana_, d6banc_, d6band_, d6bane_, d6banf_, d6bang_, d6banh_
    automated match to d2l0sa_

Details for d6bano_

PDB Entry: 6ban (more details), 1.95 Å

PDB Description: potent and selective antitumor activity of a t-cell engaging bispecific antibody targeting a membrane-proximal epitope of ror1
PDB Compounds: (O:) Inactive tyrosine-protein kinase transmembrane receptor ROR1

SCOPe Domain Sequences for d6bano_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bano_ g.14.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
apwcftldenfksdlcdipac

SCOPe Domain Coordinates for d6bano_:

Click to download the PDB-style file with coordinates for d6bano_.
(The format of our PDB-style files is described here.)

Timeline for d6bano_: