Lineage for d6ba5d_ (6ba5 D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (223 PDB entries)
  8. 3053414Domain d6ba5d_: 6ba5 D: [353476]
    Other proteins in same PDB: d6ba5a_, d6ba5c_, d6ba5e_, d6ba5g_, d6ba5m_, d6ba5n_, d6ba5o_, d6ba5p_
    automated match to d4rzca_

Details for d6ba5d_

PDB Entry: 6ba5 (more details), 1.62 Å

PDB Description: potent and selective antitumor activity of a t-cell engaging bispecific antibody targeting a membrane-proximal epitope of ror1
PDB Compounds: (D:) Variable domain Heavy chain, antibody R11

SCOPe Domain Sequences for d6ba5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ba5d_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis

SCOPe Domain Coordinates for d6ba5d_:

Click to download the PDB-style file with coordinates for d6ba5d_.
(The format of our PDB-style files is described here.)

Timeline for d6ba5d_:

  • d6ba5d_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-14