Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) duplication: contains two domains of this fold |
Family d.134.1.0: automated matches [254284] (1 protein) not a true family |
Protein automated matches [254663] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [353430] (4 PDB entries) |
Domain d6c3ma4: 6c3m A:426-570 [353470] Other proteins in same PDB: d6c3ma1, d6c3ma3 automated match to d1aopa4 complexed with k, po4, sf4, srm |
PDB Entry: 6c3m (more details), 1.5 Å
SCOPe Domain Sequences for d6c3ma4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c3ma4 d.134.1.0 (A:426-570) automated matches {Escherichia coli [TaxId: 83333]} pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag egfgdftvragiirpvldpardlwd
Timeline for d6c3ma4: