Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) duplication: contains two subdomains of this fold |
Family d.58.36.0: automated matches [254283] (1 protein) not a true family |
Protein automated matches [254662] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [353425] (4 PDB entries) |
Domain d6c3za1: 6c3z A:82-147 [353429] Other proteins in same PDB: d6c3za2, d6c3za4 automated match to d1aopa1 complexed with k, po4, sf4, srm |
PDB Entry: 6c3z (more details), 1.68 Å
SCOPe Domain Sequences for d6c3za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c3za1 d.58.36.0 (A:82-147) automated matches {Escherichia coli [TaxId: 83333]} lrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsvg ldalat
Timeline for d6c3za1: