Lineage for d6c3za1 (6c3z A:82-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955515Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. 2955516Protein automated matches [254662] (3 species)
    not a true protein
  7. 2955524Species Escherichia coli [TaxId:83333] [353425] (4 PDB entries)
  8. 2955531Domain d6c3za1: 6c3z A:82-147 [353429]
    Other proteins in same PDB: d6c3za2, d6c3za4
    automated match to d1aopa1
    complexed with k, po4, sf4, srm

Details for d6c3za1

PDB Entry: 6c3z (more details), 1.68 Å

PDB Description: t477a sirhp
PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d6c3za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c3za1 d.58.36.0 (A:82-147) automated matches {Escherichia coli [TaxId: 83333]}
lrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsvg
ldalat

SCOPe Domain Coordinates for d6c3za1:

Click to download the PDB-style file with coordinates for d6c3za1.
(The format of our PDB-style files is described here.)

Timeline for d6c3za1: