Lineage for d6bu3b_ (6bu3 B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (75 PDB entries)
  8. 3053366Domain d6bu3b_: 6bu3 B: [353428]
    automated match to d1ylpa_
    complexed with 3gk, so4

Details for d6bu3b_

PDB Entry: 6bu3 (more details), 1.15 Å

PDB Description: ctx-m-27 beta-lactamase in complex with a non-covalent tetrazole inhibitor
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6bu3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bu3b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikhadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d6bu3b_:

Click to download the PDB-style file with coordinates for d6bu3b_.
(The format of our PDB-style files is described here.)

Timeline for d6bu3b_:

  • d6bu3b_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-14