SCOPe 2.08: Domain d6bt6a1: 6bt6 A:26-290

Lineage for d6bt6a1 (6bt6 A:26-290)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)

8. Domain d6bt6a1: 6bt6 A:26-290 [353417]
   Other proteins in same PDB: d6bt6a2
   automated match to d4ua6a_
   complexed with 3gk

Details for d6bt6a1

PDB Entry: 6bt6, 1.05 Å

PDB Description: ctx-m-14 s237a beta-lactamase in complex with a non-covalent tetrazole inhibitor

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6bt6a1:

Sequence; same for both SEQRES and ATOM records:

>d6bt6a1 e.3.1.1 (A:26-290) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgagdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

Timeline for d6bt6a1:

• d6bt6a1 first appeared in SCOPe 2.07