Lineage for d6bt6a1 (6bt6 A:26-290)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (75 PDB entries)
  8. 3053355Domain d6bt6a1: 6bt6 A:26-290 [353417]
    Other proteins in same PDB: d6bt6a2
    automated match to d4ua6a_
    complexed with 3gk

Details for d6bt6a1

PDB Entry: 6bt6 (more details), 1.05 Å

PDB Description: ctx-m-14 s237a beta-lactamase in complex with a non-covalent tetrazole inhibitor
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6bt6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bt6a1 e.3.1.1 (A:26-290) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgagdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d6bt6a1:

Click to download the PDB-style file with coordinates for d6bt6a1.
(The format of our PDB-style files is described here.)

Timeline for d6bt6a1:

  • d6bt6a1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-14

View in 3D
Domains from same chain:
(mouse over for more information)
d6bt6a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6bt6b_