Lineage for d6aq1a1 (6aq1 A:1-133)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396239Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 2396242Species Human (Homo sapiens) [TaxId:9606] [50849] (20 PDB entries)
  8. 3053354Domain d6aq1a1: 6aq1 A:1-133 [353416]
    Other proteins in same PDB: d6aq1a2, d6aq1b2
    automated match to d4tkba_
    complexed with plm, so4

Details for d6aq1a1

PDB Entry: 6aq1 (more details), 1.4 Å

PDB Description: the crystal structure of human fabp3
PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d6aq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aq1a1 b.60.1.2 (A:1-133) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

SCOPe Domain Coordinates for d6aq1a1:

Click to download the PDB-style file with coordinates for d6aq1a1.
(The format of our PDB-style files is described here.)

Timeline for d6aq1a1:

  • d6aq1a1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-14

View in 3D
Domains from same chain:
(mouse over for more information)
d6aq1a2