Lineage for d5zabk1 (5zab K:1-189)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711269Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries)
  8. 2711320Domain d5zabk1: 5zab K:1-189 [353408]
    Other proteins in same PDB: d5zaba2, d5zabb2, d5zabc2, d5zabd2, d5zabe2, d5zabf2, d5zabg2, d5zabh2, d5zabi2, d5zabj2, d5zabk2, d5zabm2, d5zabn2, d5zabo2
    automated match to d4nqga_
    complexed with 9a3

Details for d5zabk1

PDB Entry: 5zab (more details), 2.15 Å

PDB Description: crystal structure of cf3-aequorin
PDB Compounds: (K:) Aequorin-2

SCOPe Domain Sequences for d5zabk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zabk1 a.39.1.5 (K:1-189) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
gkltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkd
aveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdq
ngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpac
eklyggavp

SCOPe Domain Coordinates for d5zabk1:

Click to download the PDB-style file with coordinates for d5zabk1.
(The format of our PDB-style files is described here.)

Timeline for d5zabk1: