Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (21 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries) |
Domain d5zabk1: 5zab K:1-189 [353408] Other proteins in same PDB: d5zaba2, d5zabb2, d5zabc2, d5zabd2, d5zabe2, d5zabf2, d5zabg2, d5zabh2, d5zabi2, d5zabj2, d5zabk2, d5zabm2, d5zabn2, d5zabo2 automated match to d4nqga_ complexed with 9a3 |
PDB Entry: 5zab (more details), 2.15 Å
SCOPe Domain Sequences for d5zabk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zabk1 a.39.1.5 (K:1-189) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} gkltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkd aveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdq ngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpac eklyggavp
Timeline for d5zabk1:
View in 3D Domains from other chains: (mouse over for more information) d5zaba1, d5zaba2, d5zabb1, d5zabb2, d5zabc1, d5zabc2, d5zabd1, d5zabd2, d5zabe1, d5zabe2, d5zabf1, d5zabf2, d5zabg1, d5zabg2, d5zabh1, d5zabh2, d5zabi1, d5zabi2, d5zabj1, d5zabj2, d5zabl_, d5zabm1, d5zabm2, d5zabn1, d5zabn2, d5zabo1, d5zabo2, d5zabp_ |