Lineage for d6c4cb_ (6c4c B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838112Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2838136Protein Isocitrate lyase [51642] (5 species)
    elaborated with additional subdomains
  7. 2838155Species Mycobacterium tuberculosis [TaxId:652616] [322477] (5 PDB entries)
  8. 2838177Domain d6c4cb_: 6c4c B: [353388]
    Other proteins in same PDB: d6c4ca2
    automated match to d5dqla_
    complexed with 3np, glv, mg, pyr

    has additional subdomain(s) that are not in the common domain

Details for d6c4cb_

PDB Entry: 6c4c (more details), 2.2 Å

PDB Description: crystal structure of 3-nitropropionate modified isocitrate lyase from mycobacterium tuberculosis with glyoxylate and pyruvate
PDB Compounds: (B:) Isocitrate lyase 1

SCOPe Domain Sequences for d6c4cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c4cb_ c.1.12.7 (B:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 652616]}
msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
wedqlasekkxghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
steegqf

SCOPe Domain Coordinates for d6c4cb_:

Click to download the PDB-style file with coordinates for d6c4cb_.
(The format of our PDB-style files is described here.)

Timeline for d6c4cb_: