Lineage for d5xq5a_ (5xq5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790496Species Escherichia coli [TaxId:83333] [353360] (2 PDB entries)
  8. 2790498Domain d5xq5a_: 5xq5 A: [353361]
    automated match to d5ie8a_

Details for d5xq5a_

PDB Entry: 5xq5 (more details)

PDB Description: nmr structure of the domain 5 of the e. coli ribosomal protein s1
PDB Compounds: (A:) 30S ribosomal protein S1

SCOPe Domain Sequences for d5xq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xq5a_ b.40.4.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
kanpwqqfaethnkgdrvegkiksitdfgifigldggidglvhlsdiswnvageeavrey
kkgdeiaavvlqvdaererislgvkqlaedpfnn

SCOPe Domain Coordinates for d5xq5a_:

Click to download the PDB-style file with coordinates for d5xq5a_.
(The format of our PDB-style files is described here.)

Timeline for d5xq5a_: