Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Escherichia coli [TaxId:83333] [353360] (2 PDB entries) |
Domain d5xq5a_: 5xq5 A: [353361] automated match to d5ie8a_ |
PDB Entry: 5xq5 (more details)
SCOPe Domain Sequences for d5xq5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xq5a_ b.40.4.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} kanpwqqfaethnkgdrvegkiksitdfgifigldggidglvhlsdiswnvageeavrey kkgdeiaavvlqvdaererislgvkqlaedpfnn
Timeline for d5xq5a_: