SCOPe 2.08: Domain d5xtya2: 5xty A:284-446

Lineage for d5xtya2 (5xty A:284-446)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (30 species)
   not a true protein

7. Species Cocos nucifera [TaxId:13894] [340731] (2 PDB entries)

8. Domain d5xtya2: 5xty A:284-446 [353349]
   automated match to d5wpwa2

Details for d5xtya2

PDB Entry: 5xty, 2.2 Å

PDB Description: crystal structure of 11s allergen from cocos nucifera l.

PDB Compounds: (A:) 11S globulin isoform 1

SCOPe Domain Sequences for d5xtya2:

Sequence, based on SEQRES records:

>d5xtya2 b.82.1.0 (A:284-446) automated matches {Cocos nucifera [TaxId: 13894]}
eetycsmkikqnigdprradvfnprggrittlnseklpilrfiqmsaervvlyrnamvsp
hwninahsimyctggrgrvevaddrgetvfdgelrqgqllivpqnfamleragsagfqlv
siktsdramvstvvgktsalrgmpvevlmnsyrlsrdearrvk

Sequence, based on observed residues (ATOM records):

>d5xtya2 b.82.1.0 (A:284-446) automated matches {Cocos nucifera [TaxId: 13894]}
eetycsmkikqnigdprradvfnprggrittlnseklpilrfiqmsaervvlyrnamvsp
hwninahsimyctggrgrvevaddrgetvfdgelrqgqllivpqnfamleragsagfqlv
siktsdramvstvvglrgmpvevlmnsyrlsrdearrvk

Timeline for d5xtya2:

• d5xtya2 first appeared in SCOPe 2.07