Lineage for d1g8jc2 (1g8j C:5-682)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74683Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
  4. 74684Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
  5. 74685Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (5 proteins)
  6. 74686Protein Arsenite oxidase large subunit [53715] (1 species)
  7. 74687Species Alcaligenes faecalis [TaxId:511] [53716] (2 PDB entries)
  8. 74693Domain d1g8jc2: 1g8j C:5-682 [35333]
    Other proteins in same PDB: d1g8ja1, d1g8jb_, d1g8jc1, d1g8jd_

Details for d1g8jc2

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8jc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8jc2 c.81.1.1 (C:5-682) Arsenite oxidase large subunit {Alcaligenes faecalis}
dritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplast
ltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsapr
lyaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtgklmf
saiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyfl
nhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiepg
tdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkraa
ewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmgghq
egytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqam
qkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmnge
rrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafnd
gfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyteg
kfdtddgkahfkpapwng

SCOP Domain Coordinates for d1g8jc2:

Click to download the PDB-style file with coordinates for d1g8jc2.
(The format of our PDB-style files is described here.)

Timeline for d1g8jc2: