Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Scheffersomyces stipitis [TaxId:322104] [328851] (23 PDB entries) |
Domain d5xqaa3: 5xqa A:532-677 [353311] Other proteins in same PDB: d5xqaa1, d5xqaa2 automated match to d1gpua3 complexed with ca, hsx, tpp |
PDB Entry: 5xqa (more details), 1.14 Å
SCOPe Domain Sequences for d5xqaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xqaa3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]} egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe gvaeraaktvafykgkdvvsplrsaf
Timeline for d5xqaa3: