Lineage for d1g8kg2 (1g8k G:4-682)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27580Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
  4. 27581Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
  5. 27582Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (5 proteins)
  6. Protein Arsenite oxidase large subunit [53715] (1 species)
  7. Species Alcaligenes faecalis [TaxId:511] [53716] (2 PDB entries)
  8. Domain d1g8kg2: 1g8k G:4-682 [35331]
    Other proteins in same PDB: d1g8ka1, d1g8kb_, d1g8kc1, d1g8kd_, d1g8ke1, d1g8kf_, d1g8kg1, d1g8kh_

Details for d1g8kg2

PDB Entry: 1g8k (more details), 1.64 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8kg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8kg2 c.81.1.1 (G:4-682) Arsenite oxidase large subunit {Alcaligenes faecalis}
ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
gkfdtddgkahfkpapwng

SCOP Domain Coordinates for d1g8kg2 are not available.

Timeline for d1g8kg2:

Domains from same chain:
(mouse over for more information)
d1g8kg1
Domains from other chains:
(mouse over for more information)
d1g8ka1, d1g8ka2, d1g8kb_, d1g8kc1, d1g8kc2, d1g8kd_, d1g8ke1, d1g8ke2, d1g8kf_, d1g8kh_