Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.18: HydB/Nqo4-like [56761] (1 superfamily) 3 domains: (1) all-alpha; (2&3) alpha+beta |
Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) |
Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins) |
Protein automated matches [190109] (8 species) not a true protein |
Species Desulfovibrio vulgaris [TaxId:883] [186833] (12 PDB entries) |
Domain d5xlgl_: 5xlg L: [353304] Other proteins in same PDB: d5xlgs_ automated match to d4ud6r_ complexed with f3s, mg, mpd, nfv, sf4, trs |
PDB Entry: 5xlg (more details), 1.64 Å
SCOPe Domain Sequences for d5xlgl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xlgl_ e.18.1.1 (L:) automated matches {Desulfovibrio vulgaris [TaxId: 883]} ssysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftq rtcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvd vtaalkadpakaakvassisprkttaadlkavqdklktfvesgqlgpftnayflgghpay yldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaef ealwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgv vfkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkapry mgepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietavia eyvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfql vvpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh
Timeline for d5xlgl_: