Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
Protein Nickel-iron hydrogenase, small subunit [56772] (5 species) |
Species Desulfovibrio vulgaris [TaxId:881] [56774] (16 PDB entries) |
Domain d5xlfs_: 5xlf S: [353291] Other proteins in same PDB: d5xlfl_ automated match to d1ubks_ complexed with f3s, mg, mpd, nfv, sf4 |
PDB Entry: 5xlf (more details), 1.71 Å
SCOPe Domain Sequences for d5xlfs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xlfs_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfovibrio vulgaris [TaxId: 881]} prrpsvvylhnaectgcsesvlrafepyidtlildtlsldyhetimaaagdaaeaaleqa vnsphgfiavveggiptaangiygkvanhtmldicsrilpkaqaviaygtcatfggvqaa kpnptgakgvndalkhlgvkainiagcppnpynlvgtivyylknkaapeldslnrptmff gqtvheqcprlphfdagefapsfeseearkgwclyelgckgpvtmnncpkikfnqtnwpv daghpcigcsepdfwdamtpfyqn
Timeline for d5xlfs_: