SCOPe 2.08: Domain d6dcva2: 6dcv A:107-214

Lineage for d6dcva2 (6dcv A:107-214)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d6dcva2: 6dcv A:107-214 [353264]
Other proteins in same PDB: d6dcva1, d6dcvb1, d6dcvb2, d6dcvh1, d6dcvh2, d6dcvl1
automated match to d1dn0a2
complexed with gol

Details for d6dcva2

PDB Entry: 6dcv (more details), 1.9 Å

PDB Description: crystal structure of human anti-tau antibody cbtau-27.1

PDB Compounds: (A:) Light chain of CBTAU27.1 Fab

SCOPe Domain Sequences for d6dcva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dcva2 b.1.1.2 (A:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d6dcva2:

Click to download the PDB-style file with coordinates for d6dcva2.
(The format of our PDB-style files is described here.)

Timeline for d6dcva2: