Lineage for d6cqnd1 (6cqn D:2-123)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3053193Domain d6cqnd1: 6cqn D:2-123 [353255]
    Other proteins in same PDB: d6cqna1, d6cqna2, d6cqnb1, d6cqnb2, d6cqnd2
    automated match to d3gsna1
    complexed with cl, mg, nag, so4

Details for d6cqnd1

PDB Entry: 6cqn (more details), 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex
PDB Compounds: (D:) F5 alpha chain

SCOPe Domain Sequences for d6cqnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqnd1 b.1.1.0 (D:2-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnveqspqslhvqegdstnftcsfpssnfyalhwyrwetakspealfvmtlngdekkkgr
isatlntkegysylyikgsqpedsatylcafkaagnkltfgggtrvlvkpn

SCOPe Domain Coordinates for d6cqnd1:

Click to download the PDB-style file with coordinates for d6cqnd1.
(The format of our PDB-style files is described here.)

Timeline for d6cqnd1:

  • d6cqnd1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-07