Lineage for d1aa6_2 (1aa6 1-564)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493658Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 493659Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 493660Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (9 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 493687Protein Formate dehydrogenase H [53711] (1 species)
  7. 493688Species Escherichia coli [TaxId:562] [53712] (3 PDB entries)
  8. 493689Domain d1aa6_2: 1aa6 1-564 [35324]
    Other proteins in same PDB: d1aa6_1

Details for d1aa6_2

PDB Entry: 1aa6 (more details), 2.3 Å

PDB Description: reduced form of formate dehydrogenase h from e. coli

SCOP Domain Sequences for d1aa6_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa6_2 c.81.1.1 (1-564) Formate dehydrogenase H {Escherichia coli}
mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
qkfaravigtnnvdccarvchgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
sylfkekfdtpnglaqfftcdwva

SCOP Domain Coordinates for d1aa6_2:

Click to download the PDB-style file with coordinates for d1aa6_2.
(The format of our PDB-style files is described here.)

Timeline for d1aa6_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aa6_1