Lineage for d6futa1 (6fut A:16-243)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406399Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)
  8. 2406438Domain d6futa1: 6fut A:16-243 [353222]
    Other proteins in same PDB: d6futa2
    automated match to d1op8a_
    complexed with e82, sin

Details for d6futa1

PDB Entry: 6fut (more details), 1.5 Å

PDB Description: complement factor d in complex with the inhibitor (s)-3'- (aminomethyl)-n-(1,2,3,4-tetrahydronaphthalen-1-yl)-[1,1'-biphenyl]- 3-carboxamide
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d6futa1:

Sequence, based on SEQRES records: (download)

>d6futa1 b.47.1.2 (A:16-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

Sequence, based on observed residues (ATOM records): (download)

>d6futa1 b.47.1.2 (A:16-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclegkvqvllgahslsqpe
pskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcd
vagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsckgdsg
gplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d6futa1:

Click to download the PDB-style file with coordinates for d6futa1.
(The format of our PDB-style files is described here.)

Timeline for d6futa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6futa2