SCOPe 2.07: Domain d6co2d2: 6co2 D:1538-1603

Lineage for d6co2d2 (6co2 D:1538-1603)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (8 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1 [110163] (1 species)
   duplication; contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [110164] (18 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d6co2d2: 6co2 D:1538-1603 [353199]
   automated match to d1ssfa2
   protein/RNA complex

Details for d6co2d2

PDB Entry: 6co2, 2.49 Å

PDB Description: structure of an engineered protein (nudt16ti) in complex with 53bp1 tudor domains

PDB Compounds: (D:) TP53-binding protein 1

SCOPe Domain Sequences for d6co2d2:

Sequence; same for both SEQRES and ATOM records:

>d6co2d2 b.34.9.1 (D:1538-1603) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglg

Timeline for d6co2d2:

• d6co2d2 is new in SCOPe 2.07-stable
  
• d6co2d2 appears in the current release, SCOPe 2.08