SCOPe 2.08: Domain d6bvpa1: 6bvp A:3-171

Lineage for d6bvpa1 (6bvp A:3-171)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
   Pfam PF06052; 3-HAO

6. Protein automated matches [311561] (3 species)
   not a true protein

7. Species Cupriavidus metallidurans [TaxId:119219] [353164] (5 PDB entries)

8. Domain d6bvpa1: 6bvp A:3-171 [353195]
   Other proteins in same PDB: d6bvpa2
   automated match to d4r52a_
   complexed with fe2, trs

Details for d6bvpa1

PDB Entry: 6bvp, 1.9 Å

PDB Description: crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase n27a from cupriavidus metallidurans

PDB Compounds: (A:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOPe Domain Sequences for d6bvpa1:

Sequence; same for both SEQRES and ATOM records:

>d6bvpa1 b.82.1.20 (A:3-171) automated matches {Cupriavidus metallidurans [TaxId: 119219]}
tygapfnfprwidehahllkppvgarqvwqdsdfivtvvggpnhrtdyhddpleeffyql
rgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldgfe
wycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpg

Timeline for d6bvpa1:

• d6bvpa1 first appeared in SCOPe 2.07